Blog

You can buy experimental Laser system for experiments in Wave Genetics and Torsion fields. Creation on their basis of individual meditative musical programs. We also translate into the melody the sequenced sections of genes, thereby producing Music of DNA.

Music of Painting – Floating Islands in the Sky

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the picture sounds – Adele Angel Daniel B Holeman

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

meditation omtec – Subtle world noosphere of the planet

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Translation of a picture to music – Olga Sheveleva

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the image sounds – Veil Nebula

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Music from the Pleiades image

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the picture sings subtle worlds

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)—————————–Translation into a melody from amino acid assembly sequences.The melody of the translation (assembly) of amino acids (proteins) from the mRNA template region of the human GJB2 gene—————————–Homo sapiens gap junction protein beta 2 (GJB2), mRNA/ gene = ”GJB2 ″/ Translation = “MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVW GDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEK KRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDG …

DNA Music – sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]

Transfer to the melody of the amino acid assembly sequence of the sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]